missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR7/RDC-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13885
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
CXCR7/RDC-1 Polyclonal specifically detects CXCR7/RDC-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| CXCR7/RDC-1 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| chemokine (C-X-C motif) receptor 7, Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7, CXC-R7, CXCR-7, G protein-coupled receptor, GPR159G-protein coupled receptor 159, RDC-1, RDC1G-protein coupled receptor RDC1 homolog | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ACKR3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY | |
| 0.1 mL | |
| GPCR | |
| 57007 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu