missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR7/RDC-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-58162-25ul
This item is not returnable.
View return policy
Description
CXCR7/RDC-1 Polyclonal specifically detects CXCR7/RDC-1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| CXCR7/RDC-1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| chemokine (C-X-C motif) receptor 7, Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7, CXC-R7, CXCR-7, G protein-coupled receptor, GPR159G-protein coupled receptor 159, RDC-1, RDC1G-protein coupled receptor RDC1 homolog | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| ACKR3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY | |
| 25 μL | |
| Chemokines and Cytokines, GPCR | |
| 57007 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction