missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR7/RDC-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
369.00 € - 549.00 €
Specifications
| Antigen | CXCR7/RDC-1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217221
|
Novus Biologicals
NBP2-58162 |
100 μL |
549.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18660467
|
Novus Biologicals
NBP2-58162-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CXCR7/RDC-1 Polyclonal specifically detects CXCR7/RDC-1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| CXCR7/RDC-1 | |
| Polyclonal | |
| Rabbit | |
| Chemokines and Cytokines, GPCR | |
| chemokine (C-X-C motif) receptor 7, Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7, CXC-R7, CXCR-7, G protein-coupled receptor, GPR159G-protein coupled receptor 159, RDC-1, RDC1G-protein coupled receptor RDC1 homolog | |
| ACKR3 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| 57007 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title