missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CYP2S1 Polyclonal specifically detects CYP2S1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | CYP2S1 |
| Applications | Immunocytochemistry, Immunofluorescence, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CYPIIS1, cytochrome P450 2S1, cytochrome P450 family member predicted from ESTs, cytochrome P450, family 2, subfamily S, polypeptide 1, cytochrome P450, subfamily IIS, polypeptide 1, cytochrome P540, subfamily IIS, polypeptide 1, EC 1.14.14.1 |
| Gene Symbols | CYP2S1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?