missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CYP39A1 Polyclonal antibody specifically detects CYP39A1 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | CYP39A1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | PE |
| Formulation | PBS |
| Gene Alias | Cytochrome P450 39A1, cytochrome P450, family 39, subfamily A, polypeptide 1, cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1,24-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.99, hCYP39A1, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2).,, Sequence:, MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?