missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CYP7B1 Polyclonal antibody specifically detects CYP7B1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | CYP7B1 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | PE |
| Formulation | PBS |
| Gene Alias | CBAS3, CP7B, Cytochrome P450 7B1, cytochrome P450, family 7, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.100, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase, spastic paraplegia 5A (autosomal recessive), SPG5A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP7B1 (NP_004811.1).,, Sequence:, VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?