missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DBC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85304-25ul
This item is not returnable.
View return policy
Description
DBC1 Polyclonal antibody specifically detects DBC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| DBC1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| DBCCR1deleted in bladder cancer protein 1, deleted in bladder cancer 1, deleted in bladder cancer chromosome region candidate 1, FAM5AbA574M5.1 (deleted in bladder cancer chromosome region candidate 1 (IB3089A)), Protein FAM5A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS | |
| 25 μL | |
| Breast Cancer, Cancer, Cell Cycle and Replication, p53 Pathway, Tumor Suppressors | |
| 1620 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction