missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DBC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
396.00 € - 521.00 €
Specifications
| Antigen | DBC1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18426081
|
Novus Biologicals
NBP1-85304 |
0.1 mL |
521.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18408811
|
Novus Biologicals
NBP1-85304-25ul |
25 μL |
396.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
DBC1 Polyclonal antibody specifically detects DBC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| DBC1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Cell Cycle and Replication, p53 Pathway, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1620 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DBCCR1deleted in bladder cancer protein 1, deleted in bladder cancer 1, deleted in bladder cancer chromosome region candidate 1, FAM5AbA574M5.1 (deleted in bladder cancer chromosome region candidate 1 (IB3089A)), Protein FAM5A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts