missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDHD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 572.00 €
Specifications
| Antigen | DDHD2 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18438720
|
Novus Biologicals
NBP1-82967-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18460581
|
Novus Biologicals
NBP1-82967 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DDHD2 Polyclonal antibody specifically detects DDHD2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| DDHD2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DDHD domain containing 2, DDHD domain-containing protein 2, EC 3.1.1.-, KIAA0725PA-PLA1 like, phospholipase DDHD2, SAM, WWE and DDHD domain containing 1, SAM, WWE and DDHD domain-containing protein 1, SAMWD1, sec23p-interacting protein p125-like phosphatidic acid-preferring phospholipaseA1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GDKDNKYVPYSESFSQVLEETYMLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQGRPRTV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 23259 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title