missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
DDX17 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92878-0.02ml
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
DDX17 Polyclonal antibody specifically detects DDX17 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifikationer
| DDX17 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, DEAD box protein 17, DEAD box protein p72, DEAD/H box 17, DKFZp761H2016, EC 3.6.1, EC 3.6.4.13, P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD), probable ATP-dependent RNA helicase DDX17, RH70, RNA-dependent helicase p72 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 170-240 of human DDX17 (NP_006377.2). VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLE | |
| 0.02 mL | |
| Translation Control, Vision | |
| 10521 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering