missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEFB119 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-84280
This item is not returnable.
View return policy
Description
DEFB119 Polyclonal specifically detects DEFB119 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DEFB119 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Beta-defensin 120, Beta-defensin 19, Beta-defensin 20, DEFB120, DEFB19, DEFB-19MGC71893, DEFB20, DEFB-20beta-defensin 119, defensin, beta 119ESC42-RELA, Defensin, beta 120ESC42-RELB, defensin, beta 19, defensin, beta 20 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 245932 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DEFB119 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction