missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEFB119 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
433.00 € - 624.00 €
Specifications
| Antigen | DEFB119 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18488040
|
Novus Biologicals
NBP1-84280-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18214496
|
Novus Biologicals
NBP1-84280 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DEFB119 Polyclonal specifically detects DEFB119 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DEFB119 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 245932 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Beta-defensin 120, Beta-defensin 19, Beta-defensin 20, DEFB120, DEFB19, DEFB-19MGC71893, DEFB20, DEFB-20beta-defensin 119, defensin, beta 119ESC42-RELA, Defensin, beta 120ESC42-RELB, defensin, beta 19, defensin, beta 20 | |
| DEFB119 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title