missing translation for 'onlineSavingsMsg'
Learn More

Dnmt2 Antibody, Novus Biologicals™

Product Code. p-200072745 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18168838 0.1 mL 0.1mL
18697255 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Código de producto. 18168838 Proveedor Novus Biologicals N.º de proveedor NBP247483

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Dnmt2 Polyclonal specifically detects Dnmt2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen Dnmt2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DMNT2, DNA (cytosine-5-)-methyltransferase 2, DNA (cytosine-5)-methyltransferase-like protein 2, DNA methyltransferase homolog HsaIIP, DNA methyltransferase-2, DNA MTase homolog HsaIIP, Dnmt2, EC 2.1.1, EC 2.1.1.29, M.HsaIIP, MHSAIIP, PuMet, RNMT1, tRNA (cytosine-5-)-methyltransferase, tRNA aspartic acid methyltransferase 1
Gene Symbols TRDMT1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRT
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Chromatin Modifiers, Chromatin Research, Epigenetics
Primary or Secondary Primary
Gene ID (Entrez) 1787
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.