missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DPPIV/CD26 Polyclonal antibody specifically detects DPPIV/CD26 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | DPPIV/CD26 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | ADABP, ADCP-2, ADCP2DPP IV, Adenosine deaminase complexing protein 2TP103, CD26 antigen, CD26T-cell activation antigen CD26, dipeptidyl peptidase 4, Dipeptidyl peptidase IV, dipeptidylpeptidase 4, dipeptidyl-peptidase 4, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2), DPPIV, EC 3.4.14.5 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?