missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
E2F8 Polyclonal antibody specifically detects E2F8 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | E2F8 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 647 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | E2F family member 8, E2F transcription factor 8, E2F-8, FLJ23311, transcription factor E2F8 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 788-867 of human E2F8 (NP_078956.2).,, Sequence:, PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?