missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ELOVL6 Polyclonal antibody specifically detects ELOVL6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | ELOVL6 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 488 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast), ELOVL fatty acid elongase 6,3-keto acyl-CoA synthase ELOVL6, FAE, fatty acid elongase 2, long-chain fatty-acyl elongase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1).,, Sequence:, LMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?