missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Exosome Component 9 Antibody, R&D Systems™

Exosome Component 9 Antibody, R&D Systems™

Code produit 18601057 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantity:
25 μL
100 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity Conditionnement
18601057 25 μL 25µL
18204194 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18601057 Fournisseur Novus Biologicals Code fournisseur NBP25756525ul
 Restricted Item
Estimated Shipment: 01-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Exosome Component 9 Polyclonal specifically detects Exosome Component 9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Spécification

Antigen Exosome Component 9
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Autoantigen PM/Scl 1, EC 3.1.13, exosome component 9Polymyositis/scleroderma autoantigen 75 kDa, p6, PM/Scl-75P75 polymyositis-scleroderma overlap syndrome-associated autoantigen, PMSCL175kD, Polymyositis/scleroderma autoantigen 1, polymyositis/scleroderma autoantigen 1 (75kD), polymyositis/scleroderma autoantigen 1, 75kDa
Gene Symbols EXOSC9
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5393
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.