missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM60A Antibody, Novus Biologicals™

FAM60A Antibody, Novus Biologicals™

Product Code. 18638888 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18638888 25 μL 25µL
18647786 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18638888 Supplier Novus Biologicals Supplier No. NBP26873425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

FAM60A Polyclonal antibody specifically detects FAM60A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen FAM60A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias C12orf14, chromosome 12 open reading frame 14, family with sequence similarity 60, member A, TERA, Tera protein homolog
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGN
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 58516
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.