missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fas/TNFRSF6/CD95 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-89034-25ul
This item is not returnable.
View return policy
Description
Fas Receptor/TNFRSF6/CD95 Polyclonal specifically detects Fas Receptor/TNFRSF6/CD95 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Fas Receptor/TNFRSF6/CD95 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ALPS1A, Apo-1, APO-1 cell surface antigen, apoptosis antigen 1, apoptosis signaling receptor FAS, Apoptosis-mediating surface antigen FAS, APT1, CD95, CD95 antigen, Fas (TNF receptor superfamily, member 6), Fas AMA, FAS1, FASLG receptor, FASTM, mutant tum | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FAS | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH | |
| 25 μL | |
| Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Diabetes Research, Hematopoietic Stem Cell Markers, Immunology, Inhibitors Activators and Regulators, Innate Immunity, Signal Transduction, Stem Cells | |
| 355 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction