missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fas/TNFRSF6/CD95 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
302.00 € - 456.00 €
Specifications
| Antigen | Fas Receptor/TNFRSF6/CD95 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400861
|
Novus Biologicals
NBP1-89034-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18780234
|
Novus Biologicals
NBP1-89034 |
456.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
Fas Receptor/TNFRSF6/CD95 Polyclonal specifically detects Fas Receptor/TNFRSF6/CD95 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Fas Receptor/TNFRSF6/CD95 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| ALPS1A, Apo-1, APO-1 cell surface antigen, apoptosis antigen 1, apoptosis signaling receptor FAS, Apoptosis-mediating surface antigen FAS, APT1, CD95, CD95 antigen, Fas (TNF receptor superfamily, member 6), Fas AMA, FAS1, FASLG receptor, FASTM, mutant tum | |
| FAS | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Diabetes Research, Hematopoietic Stem Cell Markers, Immunology, Inhibitors Activators and Regulators, Innate Immunity, Signal Transduction, Stem Cells | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 355 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title