missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
FBXW11 Polyclonal antibody specifically detects FBXW11 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | FBXW11 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | CoraFluor 1 |
| Formulation | PBS |
| Gene Alias | beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 443-542 of human FBXW11 (NP_036432.2).,, Sequence:, MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSE |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?