missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fibrinopeptide B Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Fibrinopeptide B Polyclonal antibody specifically detects Fibrinopeptide B in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Fibrinopeptide B |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | fibrinogen beta chain, fibrinogen, B beta polypeptide, MGC104327, MGC120405 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).,, Sequence:, QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?