missing translation for 'onlineSavingsMsg'
Learn More

Filamin B Antibody [HRP], Novus Biologicals Biologicals™

Product Code. 30492633 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30492633 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30492633 Supplier Novus Biologicals Supplier No. NBP337996H

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Filamin B Polyclonal antibody specifically detects Filamin B in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Filamin B
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate HRP
Formulation PBS
Gene Alias ABP-278filamin B, beta (actin binding protein 278), ABP-280 homolog, actin binding protein 278, Actin-binding-like protein, AOI, Beta-filamin, DKFZp686O033, Fh1, filamin B, beta, Filamin homolog 1, filamin-3, filamin-B, FLN1L, FLN3, FLN-B, Larsen syndrome 1 (autosomal dominant), LRS1, SCT, TABPABP-280, TAPDKFZp686A1668, Thyroid autoantigen, Truncated ABP, Truncated actin-binding protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human Filamin B (NP_001157789.1).,, Sequence:, PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2317
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.