missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GCC1 Polyclonal specifically detects GCC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
Specifications
| Antigen | GCC1 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | FLJ22035, GCC1P, GCC88Golgi coiled-coil protein 1, golgi coiled-coil 1, GRIP and coiled-coil domain containing 1, GRIP and coiled-coil domain-containing protein 1, MGC20706, peripheral membrane Golgi protein |
| Gene Symbols | GCC1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?