missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-89762
This item is not returnable.
View return policy
Description
Glut3 Polyclonal specifically detects Glut3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Polyclonal | |
| SLC2A3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT | |
| Affinity Purified | |
| IgG |
| FLJ90380, GLUT-3, GLUT3Glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3, solute carrier family 2, facilitated glucose transporter member 3 | |
| Rabbit | |
| 54 kDa | |
| 0.1 mL |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction