missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
379.00 € - 549.00 €
Specifications
| Antigen | Glut3 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18451131
|
Novus Biologicals
NBP1-89762-25ul |
25 μL |
379.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18778833
|
Novus Biologicals
NBP1-89762 |
0.1 mL |
549.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glut3 Polyclonal specifically detects Glut3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Glut3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P11169 | |
| 6515 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 54 kDa |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ90380, GLUT-3, GLUT3Glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3, solute carrier family 2, facilitated glucose transporter member 3 | |
| SLC2A3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title