missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPER/GPR30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21238-100ul
This item is not returnable.
View return policy
Description
GPER/GPR30 Polyclonal antibody specifically detects GPER/GPR30 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| GPER/GPR30 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| CEPRG-protein coupled receptor 30, Chemoattractant receptor-like 2, chemokine receptor-like 2, CMKRL2MGC99678, constitutively expressed peptide-like receptor, DRY12IL8-related receptor DRY12, FEG-1mER, Flow-induced endothelial G-protein coupled receptor 1, G protein-coupled estrogen receptor 1, G protein-coupled receptor 30, GPCR-BR, GPR30GPCR-Br, G-protein coupled estrogen receptor 1, heptahelix receptor, LERGU, LERGU2, leucine rich protein in GPR30 3'UTR, LyGPR, Lymphocyte-derived G-protein coupled receptor, Membrane estrogen receptor | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS | |
| 100 μL | |
| Breast Cancer, Cancer, GPCR, Neuroscience | |
| 2852 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunocytochemistry | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction