missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GRB2 Antibody, Novus Biologicals™

GRB2 Antibody, Novus Biologicals™

Product Code. 18681387 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18681387 25 μL 25µL
18214545 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18681387 Supplier Novus Biologicals Supplier No. NBP25520825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GRB2 Polyclonal specifically detects GRB2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GRB2
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias abundant SRC homology, Adapter protein GRB2, ASH, EGFRBP-GRB2, epidermal growth factor receptor-binding protein GRB2, Grb3-3, growth factor receptor-bound protein 2, growth factor receptor-bound protein 3, HT027, MST084, MSTP084, NCKAP2, Protein Ash, SH2/SH3 adapter GRB2
Gene Symbols GRB2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Breast Cancer, Cancer, Extracellular Matrix, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2885
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.