missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HABP1/C1QBP/GC1q R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
369.00 € - 539.00 €
Specifications
| Antigen | HABP1/C1QBP/GC1q R |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18444751
|
Novus Biologicals
NBP1-89790-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18286248
|
Novus Biologicals
NBP1-89790 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HABP1/C1QBP/GC1q R Polyclonal specifically detects HABP1/C1QBP/GC1q R in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HABP1/C1QBP/GC1q R | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| C1q globular domain-binding protein, C1qBP, complement component 1 Q subcomponent-binding protein, mitochondrial, complement component 1, q subcomponent binding protein, GC1QBP, gC1qR, gC1Q-R, GC1q-R protein, Glycoprotein gC1qBP, HABP1p33, Hyaluronan-binding protein 1, Mitochondrial matrix protein p32, p32, SF2P32, splicing factor SF2-associated protein | |
| C1QBP | |
| IgG | |
| Affinity Purified | |
| Specificity of human HABP1/C1QBP/GC1q R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 708 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title