missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonyl Reductase 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09220-100UL
This item is not returnable.
View return policy
Description
Carbonyl Reductase 2 Polyclonal specifically detects Carbonyl Reductase 2 in Mouse samples. It is validated for Western Blot.
Specifications
| Carbonyl Reductase 2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| ML | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Carbonyl Reductase 2 (NP_031647). Peptide sequence VCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSV | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 12409 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction