missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HDGFRP3 Polyclonal antibody specifically detects HDGFRP3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | HDGFRP3 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 750 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | HDGF2, HDGF-2, Hepatoma-derived growth factor 2, hepatoma-derived growth factor, related protein 3, hepatoma-derived growth factor-related protein 3, HRP-3 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-203 of human HDGFRP3 (NP_057157.1).,, Sequence:, NNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?