missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD3B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33386
This item is not returnable.
View return policy
Description
HSD3B1 Polyclonal specifically detects HSD3B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| HSD3B1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P14060 | |
| HSD3B1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT | |
| 0.1 mL | |
| Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction | |
| 3283 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction