missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD3B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | HSD3B1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18401562
|
Novus Biologicals
NBP2-33386-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18129192
|
Novus Biologicals
NBP2-33386 |
0.1 mL |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HSD3B1 Polyclonal specifically detects HSD3B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HSD3B1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P14060 | |
| 3283 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G | |
| HSD3B1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title