missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-17RE Antibody (46N7E3), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
213.00 € - 343.00 €
Specifications
| Antigen | IL-17RE |
|---|---|
| Clone | 46N7E3 |
| Concentration | 0.5 mg/mL |
| Dilution | Western Blot 5-10ug/ml∼, Flow Cytometry reported in scientific literature (PMID 27534549), Immunohistochemistry, Immunohistochemistry-Paraffin 10ug/ml∼ |
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18104635
|
Novus Biologicals
NBP2-27368SS |
0.025 mg |
213.00 €
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18775693
|
Novus Biologicals
NBP2-27368 |
343.00 €
0.10mg |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IL-17RE | |
| 0.5 mg/mL | |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Human | |
| IL-17 receptor E, interleukin 17 receptor E | |
| IL17RE | |
| IgG2b κ | |
| Protein G purified |
| 46N7E3 | |
| Western Blot 5-10ug/ml∼, Flow Cytometry reported in scientific literature (PMID 27534549), Immunohistochemistry, Immunohistochemistry-Paraffin 10ug/ml∼ | |
| Monoclonal | |
| Purified | |
| RUO | |
| Q8NFR9 | |
| 132014 | |
| amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title