missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
IP3R1 Polyclonal antibody specifically detects IP3R1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | IP3R1 |
| Applications | ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 488 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DKFZp313E1334, DKFZp313N1434, inositol 14,5-triphosphate receptor, type 1, inositol 14,5-trisphosphate receptor type 1, INSP3R1, IP3 receptor, IP3 receptor isoform 1, IP3R, IP3R 1, IP3R1, SCA15, SCA16, spinocerebellar ataxia 15, spinocerebellar ataxia 16, Type 1 inositol 14,5-trisphosphate receptor, Type 1 InsP3 receptor |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1812-1911 of human IP3R1 (NP_001365381).,, Sequence:, SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQP |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?