missing translation for 'onlineSavingsMsg'
Learn More

IP3R1 Antibody [DyLight 755], Novus Biologicals Biologicals™

Product Code. 30499202 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499202 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499202 Supplier Novus Biologicals Supplier No. NBP337937IR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

IP3R1 Polyclonal antibody specifically detects IP3R1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen IP3R1
Applications ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 755
Formulation 50mM Sodium Borate
Gene Alias DKFZp313E1334, DKFZp313N1434, inositol 14,5-triphosphate receptor, type 1, inositol 14,5-trisphosphate receptor type 1, INSP3R1, IP3 receptor, IP3 receptor isoform 1, IP3R, IP3R 1, IP3R1, SCA15, SCA16, spinocerebellar ataxia 15, spinocerebellar ataxia 16, Type 1 inositol 14,5-trisphosphate receptor, Type 1 InsP3 receptor
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1812-1911 of human IP3R1 (NP_001365381).,, Sequence:, SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQP
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 3708
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.