missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30488287

KAT2A/GCN5 Antibody [Alexa Fluor« 750], Novus Biologicals Biologicals™

Product Code. 30488287 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30488287 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30488287 Supplier Novus Biologicals Supplier No. NBP337988AF750

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

KAT2A/GCN5 Polyclonal antibody specifically detects KAT2A/GCN5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen KAT2A/GCN5
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 750
Formulation 50mM Sodium Borate
Gene Alias EC 2.3.1.48, GCN5 general control of amino-acid synthesis 5-like 2 (yeast), GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2, GCN5MGC102791, General control of amino acid synthesis protein 5-like 2, General control of amino acid synthesis, yeast, homolog-like 2, HGCN5, Histone acetyltransferase GCN5, histone acetyltransferase KAT2A, HsGCN5, K(lysine) acetyltransferase 2A, Lysine acetyltransferase 2A, PCAF-b, STAF97
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A/GCN5 (NP_066564.2).,, Sequence:, MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing, Epigenetics, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2648
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.