missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KAT2A/GCN5 Polyclonal antibody specifically detects KAT2A/GCN5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | KAT2A/GCN5 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 488 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | EC 2.3.1.48, GCN5 general control of amino-acid synthesis 5-like 2 (yeast), GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2, GCN5MGC102791, General control of amino acid synthesis protein 5-like 2, General control of amino acid synthesis, yeast, homolog-like 2, HGCN5, Histone acetyltransferase GCN5, histone acetyltransferase KAT2A, HsGCN5, K(lysine) acetyltransferase 2A, Lysine acetyltransferase 2A, PCAF-b, STAF97 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A/GCN5 (NP_066564.2).,, Sequence:, MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?