missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KChIP2 Polyclonal antibody specifically detects KChIP2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | KChIP2 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | A-type potassium channel modulatory protein 2, cardiac voltage gated potassium channel modulatory subunit, Cardiac voltage-gated potassium channel modulatory subunit, DKFZp566L1246, KChIP2, KCHIP2Kv channel-interacting protein 2, Kv channel interacting protein 2, MGC17241, potassium channel interacting protein 2, Potassium channel-interacting protein 2 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KChIP2 (NP_775284.1).,, Sequence:, MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?