missing translation for 'onlineSavingsMsg'
Learn More

KiSS1R/GPR54 Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™

Product Code. 30489632 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30489632 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30489632 Supplier Novus Biologicals Supplier No. NBP338024AF488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

KiSS1R/GPR54 Polyclonal antibody specifically detects KiSS1R/GPR54 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen KiSS1R/GPR54
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 488
Formulation 50mM Sodium Borate
Gene Alias AXOR12hypogonadotropin-1, G protein-coupled receptor 54, GPR54kiSS-1R, G-protein coupled receptor 54, G-protein coupled receptor OT7T175, HOT7T175, Hypogonadotropin-1, kiSS-1 receptor, KISS1 receptor, KiSS-1R, Kisspeptins receptor, Metastin receptor
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KiSS1R/GPR54 (NP_115940.2).,, Sequence:, SYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 84634
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.