missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
KiSS1R/GPR54 Polyclonal antibody specifically detects KiSS1R/GPR54 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | KiSS1R/GPR54 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 680 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | AXOR12hypogonadotropin-1, G protein-coupled receptor 54, GPR54kiSS-1R, G-protein coupled receptor 54, G-protein coupled receptor OT7T175, HOT7T175, Hypogonadotropin-1, kiSS-1 receptor, KISS1 receptor, KiSS-1R, Kisspeptins receptor, Metastin receptor |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KiSS1R/GPR54 (NP_115940.2).,, Sequence:, SYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?