KLF12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-21391-100ul

Se fler versioner av denna produkt

Produktkod. 18653245

708.00 € / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

KLF12 Polyclonal antibody specifically detects KLF12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifikationer

Antigen	KLF12
Classification	Polyclonal
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	AP-2rep, AP-2rep transcription factor, AP2REPAP-2 repressor, HSPC122, KLF12 zinc finger transcriptional repressor, Krueppel-like factor 12, Kruppel-like factor 12, Transcriptional repressor AP-2rep
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: SSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNV
Quantity	100 μg
Research Discipline	DNA replication Transcription Translation and Splicing
Gene ID (Entrez)	11278
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

KLF12 Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer