missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
LARP1 Polyclonal antibody specifically detects LARP1 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | LARP1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | HRP |
| Formulation | PBS |
| Gene Alias | KIAA0731LARPMGC19556, La ribonucleoprotein domain family member 1, La ribonucleoprotein domain family, member 1, la-related protein 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human LARP1 (Q6PKG0).,, Sequence:, AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?