missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LCAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76537-25ul
This item is not returnable.
View return policy
Description
LCAT Polyclonal specifically detects LCAT in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| LCAT | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| EC 2.3.1.43, lecithin-cholesterol acyltransferasePhospholipid-cholesterol acyltransferase, phosphatidylcholine-sterol acyltransferase | |
| Rabbit | |
| Affinity Purified | |
| Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction | |
| 3931.0 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| LCAT | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction