missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LCAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 599.00 €
Specifications
| Antigen | LCAT |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Research Discipline | Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18605160
|
Novus Biologicals
NBP2-76537-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18322330
|
Novus Biologicals
NBP2-76537 |
100 μL |
599.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LCAT Polyclonal specifically detects LCAT in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| LCAT | |
| Unconjugated | |
| Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction | |
| EC 2.3.1.43, lecithin-cholesterol acyltransferasePhospholipid-cholesterol acyltransferase, phosphatidylcholine-sterol acyltransferase | |
| LCAT | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 3931.0 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title