missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30515999

MEIS2 Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30515999 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30515999 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30515999 Supplier Novus Biologicals Supplier No. NBP338543MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MEIS2 Polyclonal antibody specifically detects MEIS2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MEIS2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias Meis (mouse) homolog 2, Meis homeobox 2, Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse), Meis1-related gene 1, MGC2820, myeloid ecotropic viral integration site 1 homolog 2, TALE homeobox protein Meis2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 351-470 of human MEIS2 (NP_733776.1).,, Sequence:, AYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 4212
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.