missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18604408

Glutathione Peroxidase 4/GPX4 Antibody, Novus Biologicals™

Product Code. 18604408 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
25 μL
missing translation for 'unitSize':
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit. Quantity missing translation for 'unitSize'
18604408 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 18604408 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP25522025ul
 Restricted Item
Estimated Shipment: 02-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Glutathione Peroxidase 4/GPX4 Polyclonal specifically detects Glutathione Peroxidase 4/GPX4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigen Glutathione Peroxidase 4/GPX4
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase
Gene Symbols GPX4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2879
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.