missing translation for 'onlineSavingsMsg'
Learn More
Learn More
METT10D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00 € - 529.00 €
Specifications
| Antigen | METT10D |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Knockdown Validated |
| Applications | Western Blot, Immunocytochemistry, KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18479140
|
Novus Biologicals
NBP1-81239 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18476750
|
Novus Biologicals
NBP1-81239-25ul |
25 μL |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
METT10D Polyclonal antibody specifically detects METT10D in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, KnockDownSpecifications
| METT10D | |
| Western Blot, Immunocytochemistry, KnockDown | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.1.1.-, methyltransferase 10 domain containing, Methyltransferase 10 domain-containing protein, methyltransferase like 16, METT10D, MGC3329, putative methyltransferase METT10D | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Knockdown Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 79066 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title