missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MTA1 Polyclonal antibody specifically detects MTA1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | MTA1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 525 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | metastasis associated 1, metastasis associated gene 1 protein, metastasis associated protein, metastasis-associated protein MTA1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MTA1 (NP_004680.2).,, Sequence:, LMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?