missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTMR14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33703-25ul
This item is not returnable.
View return policy
Description
MTMR14 Polyclonal specifically detects MTMR14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MTMR14 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q8NCE2 | |
| MTMR14 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLL | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C3orf29FLJ11546, chromosome 3 open reading frame 29, EC 3.1.3.-, egg-derived tyrosine phosphatase homolog, FLJ22405, FLJ46453, FLJ90311, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hEDTP, HJUMPY, jumpy, myotubularin related protein 14, myotubularin-related protein 14, NS5ATP4ABP1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 64419 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction